PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen05g030400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 296aa    MW: 33418.6 Da    PI: 8.2724
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen05g030400.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3309.21.3e-94127164353
                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSS CS
              EIN3  64 mevcnaqGfvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcd 156
                       mevc+ qGfvYgi++ekgk+v+g sdsL++WW ekv+fd+n+p+ai+k+   +l+ + e+ l+  + s    l+elqDTtl+S+Lsalmqhc 
  Sopen05g030400.1   1 MEVCKGQGFVYGIVSEKGKLVSGCSDSLQQWWMEKVRFDQNAPIAIAKS-LPKLVEE-ENMLDP-NASFMCLLEELQDTTLSSILSALMQHCI 90 
                       9************************************************.5567755.444444.7899999********************* PP

                       S-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHH CS
              EIN3 157 ppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsv 249
                       ppqrrfpl++g++pPWWPtG+elwwg +gls++qg+ppy+kph lkkawkvsvL+a ikhm p++ ++r+l+ qsk lq+km+ake+ ++++v
  Sopen05g030400.1  91 PPQRRFPLDRGLAPPWWPTGNELWWGDQGLSQEQGPPPYRKPHGLKKAWKVSVLAAIIKHMCPNLGRMRRLVNQSKNLQNKMTAKETSTWSKV 183
                       ********************************************************************************************* PP

                       HTTTTT-S--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXX CS
              EIN3 250 lnqeekecatvsahssslrkqspkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgseteli 342
                       +nqee++++     ++sl+ +  kv ++++++++ + +  +k            + + + + k    +  vs ++v++  q+ ++++s   l+
  Sopen05g030400.1 184 VNQEEALLK----LTRSLKISTSKVEVNKDKEDQLDFTFVPK------------MLTKDDKGKSIIFDDDVSMEDVVYASQNMNCPQSVLGLG 260
                       *****9762....22233334444444444444444433333............4455556667777778888899***************** PP

                       XXXXXXXXXXX CS
              EIN3 343 fadknsisqne 353
                       f dkn + ++e
  Sopen05g030400.1 261 FVDKNLRIEHE 271
                       *****998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.9E-891188No hitNo description
Gene3DG3DSA:1.10.3180.103.5E-6463192IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.14E-5768191IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MEVCKGQGFV YGIVSEKGKL VSGCSDSLQQ WWMEKVRFDQ NAPIAIAKSL PKLVEEENML  60
DPNASFMCLL EELQDTTLSS ILSALMQHCI PPQRRFPLDR GLAPPWWPTG NELWWGDQGL  120
SQEQGPPPYR KPHGLKKAWK VSVLAAIIKH MCPNLGRMRR LVNQSKNLQN KMTAKETSTW  180
SKVVNQEEAL LKLTRSLKIS TSKVEVNKDK EDQLDFTFVP KMLTKDDKGK SIIFDDDVSM  240
EDVVYASQNM NCPQSVLGLG FVDKNLRIEH ESSCSYGKVE SDIKITKKVP MTTSLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B3e-57701926128Protein ETHYLENE INSENSITIVE 3
4zds_A3e-57701926128Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015075031.10.0PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9LX161e-103EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLK4BSN21e-121K4BSN2_SOLLC; Uncharacterized protein
STRINGSolyc00g154980.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-104EIL family protein